Protein Info for RALBFv3_RS10200 in Ralstonia solanacearum IBSBF1503

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 14 to 376 (363 residues), 63.4 bits, see alignment E=4.3e-21 PF12698: ABC2_membrane_3" amino acids 30 to 373 (344 residues), 179.2 bits, see alignment E=2.5e-56 PF01061: ABC2_membrane" amino acids 183 to 345 (163 residues), 112.1 bits, see alignment E=5.8e-36 PF12730: ABC2_membrane_4" amino acids 189 to 307 (119 residues), 29.8 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 99% identity to rsc:RCFBP_21289)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>RALBFv3_RS10200 ABC transporter permease (Ralstonia solanacearum IBSBF1503)
MNVNGKRFSLHRWWSVVLKEFLQLRRDRVTFAMMIGIPIMQLLMFGFAINTDPKHLPTGV
IAADQSEFTRSFLASLRNTDYFHLAETLPDEAAGREALAEGRLQFIVSIPPDFTRRLVRG
ERPALLVEADATDPSATGLALASVTQLAQGVVSKDMKGALAPLAGGQPPFDVRVHRLYNP
EGITQYNIIPGLMGVILTMTMVMMTGLAMTRERERGTMENLLATPVRPLEVMTGKIVPYI
FIGLVQVSIILLAARFIFHVPFVGSVWMVYVAALLFIVASLTVGITLSSLAQNQLQATQL
TFFYFLPSILLSGFMFPFAGMPKWAQVIGDVLPMTYFHRLTRGILLKGNGWVELWPSIWP
LLVFTAVVMSIALRFYRKTLD