Protein Info for RALBFv3_RS10135 in Ralstonia solanacearum IBSBF1503

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 135 (129 residues), 54.1 bits, see alignment E=1e-18 amino acids 145 to 274 (130 residues), 68.4 bits, see alignment E=3.9e-23

Best Hits

KEGG orthology group: None (inferred from 97% identity to rsc:RCFBP_21304)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>RALBFv3_RS10135 ABC transporter permease (Ralstonia solanacearum IBSBF1503)
MPSNRLITILATALAPCLWGTTYIVFTQTLPVSHPLLVGALRALPAGILLMLLGPGLPPR
DKLGRLALVGVANIGVFFALLFVAAARLPGGVAATVMSVQPLIVGLLVWPVLGRRPRPAQ
LVAALAGSLGVGLLILGPAARLDAIGVVAALGAAVSMATGTVLIERWGRVGTPLALAAWQ
LALGGLVLLPVALAVEGLPPLPTLRNAAGFAYLIVIGTALGYWLWVRGIGRLGADVTFLS
LLSPLTATVLGALLLGEWFSPVQTAGALLILAATVSGMALSRRARVAGSQDNNAARPVQP
VAPRAGASR