Protein Info for RALBFv3_RS10050 in Ralstonia solanacearum IBSBF1503

Annotation: methionine adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 5 to 102 (98 residues), 140.8 bits, E=2.8e-45
• TIGR01034: methionine adenosyltransferase
  • amino acids 6 to 383 (378 residues), 601.4 bits, E=3.1e-185
• PF02772: S-AdoMet_synt_M
  • amino acids 117 to 233 (117 residues), 171.3 bits, E=1.2e-54
• PF02773: S-AdoMet_synt_C
  • amino acids 235 to 373 (139 residues), 226.4 bits, E=1.6e-71

Best Hits

Swiss-Prot: 99% identical to METK_RALSO: S-adenosylmethionine synthase (metK) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 99% identity to rso:RSc0134)

MetaCyc: 69% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• S-adenosyl-L-methionine salvage II (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (2/5 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)
• L-methionine salvage cycle III (3/11 steps found)
• superpathway of L-methionine salvage and degradation (6/16 steps found)
• L-methionine salvage cycle II (plants) (2/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Protein Sequence (396 amino acids)

>RALBFv3_RS10050 methionine adenosyltransferase (Ralstonia solanacearum IBSBF1503)
MSNDFLFTSESVSEGHPDKVADQISDAILDAILAEDKYARVAAETLCNTGLVVLAGEITT
SANVDYIHVARETIKRIGYDNTEYGIDYKGCAVLVAYDKQSPDIAQGVDRASDDYLNQGA
GDQGLMFGYACDETPELMPFPIYYAHRLVERQSQLRRDGRLPWLRPDAKSQVTVRYVNGK
PHSVDTVVLSTQHAPDISQEQIREAVIEEIIKPVLPSHMLAETKYLVNPTGRFVIGGPQG
DCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLARQCQVQ
VSYAIGVARPINITVYTEGTGVIPDEQIAKLVQEHFDLRPKGIVQMLDLLRPIYGKTAAY
GHFGREEPEFSWEATDKALLLREAAGLAGEPVKAFA