Protein Info for RALBFv3_RS09875 in Ralstonia solanacearum IBSBF1503

Annotation: methylenetetrahydrofolate reductase [NAD(P)H]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF02219: MTHFR" amino acids 4 to 275 (272 residues), 302.8 bits, see alignment E=1.3e-94 TIGR00676: methylenetetrahydrofolate reductase [NAD(P)H]" amino acids 6 to 274 (269 residues), 341.6 bits, see alignment E=1.6e-106

Best Hits

KEGG orthology group: K00297, methylenetetrahydrofolate reductase (NADPH) [EC: 1.5.1.20] (inferred from 98% identity to rso:RSc0091)

Predicted SEED Role

"5,10-methylenetetrahydrofolate reductase (EC 1.5.1.20)" in subsystem Methionine Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 1.5.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>RALBFv3_RS09875 methylenetetrahydrofolate reductase [NAD(P)H] (Ralstonia solanacearum IBSBF1503)
MQDRQFSFEFFPPKTAEGAEKLRNTRAQLSPLKPRFISVTFGAGGTTQQGTLDAVVEIQR
EGIEAAPHLSCVGSSRESIRGILDTYRANGIRRLVALRGDLPSGMGEIGEFRFANELVEF
IRKEMNDTFHIEVAAYPEYHPQARSSRQDLENFARKVKAGANSAITQYFFNADAYFQFVD
DARKLGVDVPIVPGIMPITNSSQLMRFSEMCGAEIPRWIAKRLESFGDDRESIRAFGLDV
VTALCDRLLAGGAPGLHFYTLNAAAATRAIWQRLGL