Protein Info for RALBFv3_RS09715 in Ralstonia solanacearum IBSBF1503

Annotation: rod shape-determining protein MreC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 12 to 19 (8 residues), see Phobius details amino acids 35 to 35 (1 residues), see Phobius details transmembrane" amino acids 20 to 34 (15 residues), see Phobius details amino acids 36 to 38 (3 residues), see Phobius details TIGR00219: rod shape-determining protein MreC" amino acids 9 to 276 (268 residues), 160.4 bits, see alignment E=2.6e-51 PF04085: MreC" amino acids 127 to 274 (148 residues), 139.8 bits, see alignment E=3e-45

Best Hits

KEGG orthology group: K03570, rod shape-determining protein MreC (inferred from 99% identity to rsc:RCFBP_21384)

Predicted SEED Role

"Rod shape-determining protein MreC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>RALBFv3_RS09715 rod shape-determining protein MreC (Ralstonia solanacearum IBSBF1503)
MDYSPPPLFKQGPSATARLVGLIALALALLVIDARLSVLGVVRQVVSVVLYPVERVVLIP
RDTARALLDYTQSSTRLATDNRTLRESAVAQAQQSLRASQLEAENRNLRTLLNLKQHAAV
PTVAAEVLYEARDPYTQRIVIDRGTKDGVRPGYPVIDDRGVVGQVTRVSLFEAQVTLLTD
KDQAIPVEVVRNGLRSVAFGGARAGALDLRFMAASADLQQGDLLVTSGLDGVYPAGLPVA
RIAQIERKADTAFSRVICEPVAGIRSNRHLLIVQYESGFPPPIDVAPASAPKGKNAARDA
REEKARAARAAAEANVPAPAADDNAPPPRPTDADGNPLDTDPAPKR