Protein Info for RALBFv3_RS09625 in Ralstonia solanacearum IBSBF1503

Annotation: ATP-dependent protease ATPase subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 5 to 444 (440 residues), 676.2 bits, see alignment E=1.1e-207 PF07728: AAA_5" amino acids 53 to 89 (37 residues), 22.3 bits, see alignment 2.8e-08 PF00004: AAA" amino acids 54 to 100 (47 residues), 29.1 bits, see alignment 3.2e-10 amino acids 237 to 334 (98 residues), 30.3 bits, see alignment E=1.3e-10 PF07724: AAA_2" amino acids 186 to 330 (145 residues), 101.1 bits, see alignment E=1.8e-32

Best Hits

Swiss-Prot: 99% identical to HSLU_RALSO: ATP-dependent protease ATPase subunit HslU (hslU) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 100% identity to rsc:RCFBP_21403)

MetaCyc: 66% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>RALBFv3_RS09625 ATP-dependent protease ATPase subunit HslU (Ralstonia solanacearum IBSBF1503)
MSETMTPSEIVSELDKHIIGQQKAKKAVAVALRNRWRRQQVADPLRQEITPKNILMIGPT
GVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDTIVRDLAEMAIKQTRESEMKKV
RAKAEDAAEDRLLDVLIPPPRDIGFAQPEEKDSNARQVFRKKLREGQLDDKEIELEVAAG
MPGMDIMGPPGMEEMTEQIRSMFAGLGQGKKHRRKMKVHEAFKLLVEEEAAKLVNEEELK
HKAIANVEQNGIVFLDEIDKITSRSEYGGGGEVSRQGVQRDLLPLVEGTTVSTKYGMIKT
DHILFIASGAFQLSKPSDLIPELQGRFPIRVELDSLSVDDFQAILTQTDASLTKQYQALM
KTEDVELVFADDGIRRLAEIAFSVNEKVENIGARRLYTVMERLLEDLSFHAHKSSGETVT
IDAAYVDSRLNELAGSEDLSRYVL