Protein Info for RALBFv3_RS09465 in Ralstonia solanacearum IBSBF1503

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 17 to 35 (19 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 20 to 340 (321 residues), 190.9 bits, see alignment E=1.7e-59 PF12831: FAD_oxidored" amino acids 21 to 128 (108 residues), 33.6 bits, see alignment E=1.4e-11 PF01134: GIDA" amino acids 21 to 64 (44 residues), 25.5 bits, see alignment 3.4e-09 PF00890: FAD_binding_2" amino acids 21 to 61 (41 residues), 21.6 bits, see alignment 5.7e-08 PF13450: NAD_binding_8" amino acids 24 to 77 (54 residues), 26 bits, see alignment 4.6e-09 PF00070: Pyr_redox" amino acids 186 to 259 (74 residues), 52.1 bits, see alignment E=3.9e-17 PF02852: Pyr_redox_dim" amino acids 360 to 477 (118 residues), 76.9 bits, see alignment E=7e-25

Best Hits

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 96% identity to rsc:RCFBP_21433)

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>RALBFv3_RS09465 NAD(P)/FAD-dependent oxidoreductase (Ralstonia solanacearum IBSBF1503)
MASPVEPDGRLMRANSVVSFDLIVVGAGSAGLAAARRAAQLGARTLLIDRAEVGGTSVNR
GCAPKKLLGYGATWSQAASRCLHTAAAHGREAWQDAVARIRAEAGRMHGVYRTHLAEAGV
QWLAGSASLRGRGALRLLTDAGKRTLRARQIVLATGARPQPLPVPGAELACSSGDVFTWD
TLPASLAIAGGGVIAVEMASTLARFGVRVTLLVGGPRVLPDFDVALSEAAARALAGCGVE
VVPDADVVRVERDAVNGDGVAVYLAGPDGQPRVVRAQRVMAVIGRVPATDGLGLEAAGVT
LDAHGHIAVDRHFRTRARGVHAIGDVGGGPQLTPVAVAQGGYVAERLFGKGAKLPDMAHV
PMAVFCEPAIAAVGLTEAQARARWPDRPERDTRATAERIDVVERRFVSLEQRFAGTGAES
LIKLVCNARSGRVLGAHVVDNAAPEIVQALAVAVRMGVRLKHLRSTVGLHPTVAEELLGA