Protein Info for RALBFv3_RS09235 in Ralstonia solanacearum IBSBF1503

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 49 to 66 (18 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details PF03988: DUF347" amino acids 24 to 75 (52 residues), 61.7 bits, see alignment E=3.1e-21 amino acids 79 to 129 (51 residues), 59.2 bits, see alignment 1.8e-20 amino acids 144 to 193 (50 residues), 48.4 bits, see alignment 4.6e-17 amino acids 199 to 254 (56 residues), 54.5 bits, see alignment E=5.6e-19

Best Hits

KEGG orthology group: None (inferred from 98% identity to rsc:RCFBP_10059)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>RALBFv3_RS09235 membrane protein (Ralstonia solanacearum IBSBF1503)
MNIASQVHEPVDIARSKLPEITLAFWIMKICATTLGETAGDLLSMTLKIGYAASSVLLVG
VFLVTLGAQLRSRAYHPLLYWTVILSTSTAGTTLSDFMDRTLGLGYATGSAILASLLGAV
LIYWKLSQKSLSIARVRGGKGELLYWGAILVSNTLGTALGDFLADSSGLGFAGGALLIAC
IIALIAAAYYFTDLSRVALFWMAFVLTRPLGATAGDLLTKPVSAGGLNLGTAGASLVLLA
ILLATVGYASWQARRVSLQSA