Protein Info for RALBFv3_RS09200 in Ralstonia solanacearum IBSBF1503

Annotation: flavohemoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF00042: Globin" amino acids 27 to 132 (106 residues), 49.8 bits, see alignment E=7.2e-17 PF00970: FAD_binding_6" amino acids 155 to 256 (102 residues), 25 bits, see alignment E=3.1e-09 PF00175: NAD_binding_1" amino acids 268 to 374 (107 residues), 36.9 bits, see alignment E=7.5e-13

Best Hits

KEGG orthology group: K05916, nitric oxide dioxygenase [EC: 1.14.12.17] (inferred from 99% identity to rsc:RCFBP_10066)

Predicted SEED Role

"Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17)" in subsystem Bacterial hemoglobins or Flavohaemoglobin or Glutaredoxins (EC 1.14.12.17)

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.17

Use Curated BLAST to search for 1.14.12.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>RALBFv3_RS09200 flavohemoprotein (Ralstonia solanacearum IBSBF1503)
MLSEQSKPLIDASVPVLREHGLTITQTFYRNMFASHPELTNLFNMGNQANGSQQQSLASA
VFAYAANHGNNAALAPVVGRIVHKHAAVGIRPSHYPIVARHLLGAIAEVLGDAATPALLA
AWDEAYWLLAAELIAAEARLYAHMQSGPDHRQPVRIIERRQQAEDVVSFTLEAVGGTTLA
DFLPGQYISVQVELASGVLQQRQYSLSDAPNGRTWRISVKRDAGEAGRPAGTVSNWLHEN
ARQGEVLLVSQPYGDFVPQLATDNPIVLMSAGVGITPMIAALNTLAGQNVARKVVFSHAS
RTASHVAHTDDLERAARVLPDFEAHVFLESGEAAAFASRPAQPGRMTVDAFVDGKVADAD
FYLCGPLPFMQAQRAALLASGVPAARIHREVFGPDLLDDIL