Protein Info for RALBFv3_RS08710 in Ralstonia solanacearum IBSBF1503

Annotation: glutamate--cysteine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR02050: carboxylate-amine ligase, YbdK family" amino acids 13 to 297 (285 residues), 380.4 bits, see alignment E=2.8e-118 PF04107: GCS2" amino acids 14 to 291 (278 residues), 210.2 bits, see alignment E=2.2e-66

Best Hits

Swiss-Prot: 96% identical to GCS2_RALSO: Putative glutamate--cysteine ligase 2 (RSc3298) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K06048, carboxylate-amine ligase [EC: 6.3.-.-] (inferred from 98% identity to rsc:RCFBP_10170)

MetaCyc: 48% identical to putative glutamate--cysteine ligase 2 (Escherichia coli K-12 substr. MG1655)
Glutamate--cysteine ligase. [EC: 6.3.2.2]

Predicted SEED Role

"FIG074102: hypothetical protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.2

Use Curated BLAST to search for 6.3.-.- or 6.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>RALBFv3_RS08710 glutamate--cysteine ligase (Ralstonia solanacearum IBSBF1503)
MSLEPFAQSEALTFGVELELQLVNRHDYDLASASADLLRMLKGKETPGDIKPEITESMIE
IATGICHSHDEALWQLREIRDRMVEAAVPLNIGICGGGTHPFQQWSQRTISASPRYQYIS
ELYGYLAKQFTVFGQHVHLGCPTPDDALYLLHAMSRYVPHFIALAAASPFVQGVDTGFAS
ARLNSVSAFPMSGRAPFVLTWDAFVAYFEKMRATGVIESMKDFYWDIRPKPEFGTIEVRV
MDTPLTVERAAAVAAYIQALGRWLLLDRPFVPVEDDYLVYTFNRFQACRFGLAGEYVDPA
SGQRGALADHILETSRLLAPHAEALASEGALDMVRDVVARRDSDAEWIRATEGETRNLHE
TVRRGCGRWAQATTEPA