Protein Info for RALBFv3_RS08040 in Ralstonia solanacearum IBSBF1503

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13432: TPR_16
  • amino acids 17 to 80 (64 residues), 16.4 bits, E=9.5e-06
  • amino acids 61 to 112 (52 residues), 19.5 bits, 1.1e-06
  • amino acids 121 to 182 (62 residues), 42.5 bits, 6.9e-14
  • amino acids 193 to 251 (59 residues), 20.8 bits, 4e-07
  • amino acids 256 to 314 (59 residues), 19.6 bits, 9.6e-07
  • amino acids 290 to 352 (63 residues), 26.1 bits, E=9.4e-09
  • amino acids 326 to 381 (56 residues), 19.7 bits, 9.3e-07
• PF07721: TPR_4
  • amino acids 84 to 106 (23 residues), 12.1 bits, see alignment (E = 0.00026)
  • amino acids 183 to 207 (25 residues), 17.1 bits, see alignment (E = 6.4e-06)
  • amino acids 286 to 310 (25 residues), 19.2 bits, see alignment (E = 1.4e-06)
• PF13176: TPR_7
  • amino acids 85 to 113 (29 residues), 15 bits, see alignment (E = 2.1e-05)
  • amino acids 151 to 180 (30 residues), 18.4 bits, see alignment (E = 1.6e-06)
  • amino acids 287 to 313 (27 residues), 15.5 bits, see alignment (E = 1.4e-05)
• PF13374: TPR_10
  • amino acids 85 to 110 (26 residues), 17.1 bits, see alignment (E = 4.3e-06)
  • amino acids 119 to 144 (26 residues), 17.3 bits, see alignment (E = 3.8e-06)
  • amino acids 153 to 178 (26 residues), 18.5 bits, see alignment (E = 1.6e-06)
  • amino acids 187 to 212 (26 residues), 18.8 bits, see alignment (E = 1.3e-06)
  • amino acids 289 to 311 (23 residues), 15.6 bits, see alignment (E = 1.3e-05)
• PF13181: TPR_8
  • amino acids 86 to 113 (28 residues), 15.2 bits, see alignment (E = 1.8e-05)
  • amino acids 117 to 147 (31 residues), 12.6 bits, see alignment (E = 0.00013)
  • amino acids 149 to 181 (33 residues), 25.3 bits, see alignment (E = 1.1e-08)
  • amino acids 183 to 214 (32 residues), 17.6 bits, see alignment (E = 3.3e-06)
  • amino acids 285 to 314 (30 residues), 16.2 bits, see alignment (E = 8.9e-06)
• PF07719: TPR_2
  • amino acids 117 to 147 (31 residues), 23.3 bits, see alignment (E = 4.7e-08)
  • amino acids 149 to 181 (33 residues), 28.9 bits, see alignment (E = 7.3e-10)
  • amino acids 183 to 215 (33 residues), 26.9 bits, see alignment (E = 3.2e-09)
• PF13424: TPR_12
  • amino acids 118 to 179 (62 residues), 43.6 bits, 2.7e-14
  • amino acids 149 to 213 (65 residues), 33.9 bits, E=2.8e-11
  • amino acids 253 to 314 (62 residues), 32 bits, 1.1e-10
• PF00515: TPR_1
  • amino acids 149 to 181 (33 residues), 33.1 bits, see alignment (E = 3.2e-11)
• PF13414: TPR_11
  • amino acids 157 to 197 (41 residues), 31.6 bits, 9.9e-11
• PF14559: TPR_19
  • amino acids 163 to 204 (42 residues), 27.2 bits, 3.9e-09
  • amino acids 195 to 258 (64 residues), 36.2 bits, E=5.9e-12
• PF13431: TPR_17
  • amino acids 171 to 202 (32 residues), 29.4 bits, see alignment (E = 5.8e-10)
• PF13174: TPR_6
  • amino acids 321 to 353 (33 residues), 15.3 bits, see alignment (E = 2.5e-05)
• PF13469: Sulfotransfer_3
  • amino acids 462 to 649 (188 residues), 159.7 bits, E=1.2e-49
• PF00685: Sulfotransfer_1
  • amino acids 463 to 651 (189 residues), 52 bits, E=6.6e-17

Best Hits

KEGG orthology group: None (inferred from 97% identity to rsc:RCFBP_10264)

Predicted SEED Role

"TPR domain protein"

Protein Sequence (700 amino acids)

>RALBFv3_RS08040 hypothetical protein (Ralstonia solanacearum IBSBF1503)
MSLPPSRPEILSIPEALNRAHAHWSAGQAAQAELLCQRVLAAWPGQADALHLLGLMAHAY
GHLDLAIAHLRQACLAPRAPAAYSSNLAEMYRQKGRLAEAEDAARRAVAMDPALVSGWNN
LGIVLQEAGKFAESLDCLERVIALQPDGAQAHNNLANTLRRLERLERAESHYRRALELDP
AYAEAHSNLAFLLSAQGRYDEAAAAAQHAIELSPRLVDAYLNLAEAEIGRHRHEAALRVL
DRLSPFAPQHPAALTARATVLRRIERPDEALTVARQAVALAPRSAETHHALAMALQALGQ
TDEALPHFEQATRLPGAVAEEALVGRATLLMEAGRRDAALVAFDQALEQFPGSVQARAGR
ADARTFKAGDPDIAALEACLAEGERRSLRDRISAHFALGKAYLDLQDPARAFHHLDAGNR
QKRSTFTYDGAASSRWMARIADAFPPESHDRLHATGEPSALPVFIVGMPRSGTTLIEQIV
SSHPQVTGAGELSALRLVVEGSGLFPDGMQGLEGEARGALFRQLGQAYLSRVTPLAQGRA
RLVDKMPSNFLYAGLIPLILPGARIIHARRDPVDTCLSCYTKLFAGEQPFAYDQAELGAL
YCSYARLMAHWRTVLPPERFIEIDYESVVDDLEGEARRLIDFLDLPWDPACLNFHDNRRV
VRTASVNQVRQPIYTTSKGRWQAYADYLGPLLEALGVDAP