Protein Info for RALBFv3_RS08025 in Ralstonia solanacearum IBSBF1503

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 387 to 404 (18 residues), see Phobius details PF07695: 7TMR-DISM_7TM" amino acids 215 to 403 (189 residues), 31.4 bits, see alignment E=1.8e-11 PF02518: HATPase_c" amino acids 550 to 640 (91 residues), 39.3 bits, see alignment E=7.7e-14

Best Hits

KEGG orthology group: None (inferred from 98% identity to rsc:RCFBP_10267)

Predicted SEED Role

"FIG00976264: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (643 amino acids)

>RALBFv3_RS08025 sensor histidine kinase (Ralstonia solanacearum IBSBF1503)
MRYRPTHLSAYAIFVFSVALLVIVGAIYLDADGESLPAANVHLTQAEWQVTDARGFTAPP
ATLDSKSLPNAWRQVALPLDLPIALLRQANANAVTTAGQTTWLKLAVPSLPPHSGPLALY
GVRVKTDGTIAVYADGELVHRAQQQGPLWNSTRTPLWVVLERRADDAPLREILIRLEHTE
RTQVALSSLWVGPVETLRGRYHVRQWLQQELPRMLSAAFLAVGIFALFVWFKRRRETGYL
LFFNLAVTSFLRGLHFYASLPIANDWFAWLTVNSLLWLVTVVHFFLCQLHGRKLTGFTRA
LVGVTGLIGILTLPGLAVLPNTPKVTPLIYPMAALMGAAVGLVGGISAWRRSNEGVLVAI
GVSVCTLLGVSDWLLQNNFVSPEGWYFGAYTNAITFGIFGILMCRRYINAINEVELANAN
LAQRLQQREAELERSHQRLLEVERQQTISAERQRLMQDMHDGLGASLISAIRSVERGAVS
EAKVSQILKSCLDDLKLTIDSMEPVEADLLLLLATLRFRLEPRLEGTGIALLWEIQKLPT
LTWLDPSSALHILRIVQESIANILHHTQASEIRVGTATESTGVQVTIIDNGQGFDLEKTL
AAGKGNGLRNQQRRAQAINGKVNWVSGPAGTRFTLWLPLERHA