Protein Info for RALBFv3_RS07065 in Ralstonia solanacearum IBSBF1503

Annotation: 30S ribosomal protein S4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01017: ribosomal protein uS4
  • amino acids 3 to 207 (205 residues), 264.2 bits, E=3.7e-83
• PF00163: Ribosomal_S4
  • amino acids 3 to 96 (94 residues), 106 bits, E=1.4e-34
• PF01479: S4
  • amino acids 98 to 144 (47 residues), 59.7 bits, 1.9e-20

Best Hits

Swiss-Prot: 98% identical to RS4_RALSO: 30S ribosomal protein S4 (rpsD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02986, small subunit ribosomal protein S4 (inferred from 99% identity to rsc:RCFBP_10456)

MetaCyc: 70% identical to 30S ribosomal subunit protein S4 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S4p (S9e)" in subsystem Ribosome SSU bacterial

Protein Sequence (207 amino acids)

>RALBFv3_RS07065 30S ribosomal protein S4 (Ralstonia solanacearum IBSBF1503)
MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGNQLREKQ
KVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAEARQLVS
HKAILVNGQALNVPSAQIKSGDVVAIREKSKKQVRIAESLSLAEQSGFPTWVAVDAKKME
GTFKQAPDRVDIAGDINESLIVELYSR