Protein Info for RALBFv3_RS06995 in Ralstonia solanacearum IBSBF1503

Annotation: protein-methionine-sulfoxide reductase heme-binding subunit MsrQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 51 to 70 (20 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details PF01794: Ferric_reduct" amino acids 50 to 164 (115 residues), 63.4 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 94% identical to MSRQ_RALSO: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_10470)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>RALBFv3_RS06995 protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Ralstonia solanacearum IBSBF1503)
MLPSMLSPKQLRVVKIAVWLLALVPFLRLAVLGATDQYGANPLEFVTRSTGTWTLVLLCC
TLAVTPLRRLTGMNWLIRIRRMLGLYTFFYGTLHFLIWLLVDRGLDPASMVKDIVKRPFI
TVGFAAFVLMIPLAATSTNAMVRRLGGKRWQWLHRLVYVTGVLGILHYWWHKAGKHDFAE
VSIYAAVMAVLLGLRVWWAWRATRQGAVAGGALPVRD