Protein Info for RALBFv3_RS06890 in Ralstonia solanacearum IBSBF1503

Annotation: outer membrane lipid asymmetry maintenance protein MlaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04430: outer membrane lipid asymmetry maintenance protein MlaD
  • amino acids 3 to 147 (145 residues), 205.2 bits, E=2e-65
• PF02470: MlaD
  • amino acids 38 to 116 (79 residues), 78 bits, E=2.7e-26

Best Hits

Swiss-Prot: 54% identical to MLAD_HAEIN: Intermembrane phospholipid transport system binding protein MlaD (mlaD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 98% identity to rsl:RPSI07_0538)

Predicted SEED Role

"Uncharacterized ABC transporter, periplasmic component YrbD"

Protein Sequence (172 amino acids)

>RALBFv3_RS06890 outer membrane lipid asymmetry maintenance protein MlaD (Ralstonia solanacearum IBSBF1503)
MRKSLLDFWVGLFVMVGIIALLFLALKAGNMSSFSFAKTYQVRAAFDNIGGLKVRAPVKS
AGVVVGRVSQILFDDKSYQATVVLDMDQRYQFPKDSSAKILTSGLLGEQYVGLEPGGDSA
MLASGSKITMTQSAVVLENLISQFLYSKAADAGAGNAGGGAGKPAEGGSGSK