Protein Info for RALBFv3_RS06645 in Ralstonia solanacearum IBSBF1503

Annotation: cytochrome o ubiquinol oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details TIGR02847: cytochrome o ubiquinol oxidase subunit IV" amino acids 25 to 120 (96 residues), 128.5 bits, see alignment E=5.6e-42 PF03626: COX4_pro" amino acids 32 to 105 (74 residues), 60.6 bits, see alignment E=7.8e-21

Best Hits

Swiss-Prot: 54% identical to CYOD_ECOLI: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Escherichia coli (strain K12)

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 98% identity to rsc:RCFBP_10542)

MetaCyc: 54% identical to cytochrome bo3 subunit 4 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>RALBFv3_RS06645 cytochrome o ubiquinol oxidase subunit IV (Ralstonia solanacearum IBSBF1503)
MEQTNVSPNAVQGEAHGHAAGGAGHASVKGYLIGFVLAVILTVIPFKMVMGGGFSHDTVL
VTVMALAVVQIVVHLIYFLHLDGSSAQRWNVMAFLFTLLILAIVIVGSLWVMHNMNVNMM
TH