Protein Info for RALBFv3_RS06535 in Ralstonia solanacearum IBSBF1503

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 133 to 150 (18 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details TIGR02823: putative quinone oxidoreductase, YhdH/YhfP family" amino acids 35 to 336 (302 residues), 419.4 bits, see alignment E=3.7e-130 PF08240: ADH_N" amino acids 40 to 99 (60 residues), 29.8 bits, see alignment E=4.6e-11 PF00107: ADH_zinc_N" amino acids 170 to 295 (126 residues), 59.4 bits, see alignment E=3.7e-20

Best Hits

Swiss-Prot: 56% identical to ACUI_RHOS4: Acrylyl-CoA reductase AcuI (acuI) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 97% identity to rsc:RCFBP_10565)

MetaCyc: 53% identical to acrylyl-CoA reductase (Escherichia coli K-12 substr. MG1655)
RXN-9087 [EC: 1.3.1.84]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>RALBFv3_RS06535 oxidoreductase (Ralstonia solanacearum IBSBF1503)
MSFRALMLEKQEGGTLARVTDLDDAALSSPAALADASTAGDVLVRIDWSTINYKDGLAIT
GRGPVVRKWPMVAGIDGAGTVIESSHPDWKAGDAVVLNGWGVGEMHWGCLAQRARLSGDW
LVALPAGLDTRSAMAIGTAGYTAMLSVLALECSGLRPGDGEVLVTGASGGVGSIAIAVLG
QLGYRVVASTGKTAEADFLRTLGAAEVIDRAELSAPGKPLQKERWAAVVDSVGSHTLANA
CAQVRHGGTVTACGLAQGMDFPATVAPFILRGITVHGIDSVTAPRALRQTAWQRLSTDLA
PDRLAAITREIALGEAIGVAHDILAGKMRGRVVVDVNR