Protein Info for RALBFv3_RS06490 in Ralstonia solanacearum IBSBF1503

Annotation: type 1 glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 1 to 186 (186 residues), 276.1 bits, see alignment E=7.4e-87 PF00117: GATase" amino acids 3 to 186 (184 residues), 213.3 bits, see alignment E=2.6e-67 PF07722: Peptidase_C26" amino acids 70 to 170 (101 residues), 46.2 bits, see alignment E=5e-16

Best Hits

Swiss-Prot: 70% identical to TRPG_ACIAD: Anthranilate synthase component 2 (trpG) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 99% identity to rsc:RCFBP_10575)

MetaCyc: 68% identical to anthranilate synthase beta subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27) @ Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" (EC 2.6.1.85, EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85, 4.1.3.27

Use Curated BLAST to search for 2.6.1.85 or 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (189 amino acids)

>RALBFv3_RS06490 type 1 glutamine amidotransferase (Ralstonia solanacearum IBSBF1503)
MLLMIDNYDSFTYNIVQYFGELGQDVRTYRNDEITIEDIERLNPERICLSPGPCTPKEAG
ILVPALKHFAGRIPILGVCLGHQAIGDAFGGRVIRAQKVMHGKVSTIENTGAGVFANLPR
HFKVTRYHSLAIERESLPDCLEVTAWTDDGEIMGVRHKTLPVEGVQFHPESILSEHGHAL
LANFLKERA