Protein Info for RALBFv3_RS06485 in Ralstonia solanacearum IBSBF1503

Annotation: anthranilate synthase component I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 TIGR00564: anthranilate synthase component I" amino acids 25 to 499 (475 residues), 540.3 bits, see alignment E=2.2e-166 PF04715: Anth_synt_I_N" amino acids 26 to 172 (147 residues), 120.5 bits, see alignment E=7.3e-39 PF00425: Chorismate_bind" amino acids 221 to 302 (82 residues), 55.9 bits, see alignment E=5e-19 amino acids 314 to 491 (178 residues), 238.4 bits, see alignment E=1e-74

Best Hits

KEGG orthology group: K01657, anthranilate synthase component I [EC: 4.1.3.27] (inferred from 98% identity to rsc:RCFBP_10576)

Predicted SEED Role

"Anthranilate synthase, aminase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>RALBFv3_RS06485 anthranilate synthase component I (Ralstonia solanacearum IBSBF1503)
MTELEFKSLADQGYNRIPLIAEALADLETPLSLYLKLAQSHDRGTHTFLLESVVGGERFG
RYSFIGLHARTLLRTIGNRTEVVTDGSVVETHEGNPLDFIAAFEQRHKVALRPGLPRFCG
GLAGYFGYDAVRYIEPRLAETTPPDDLQLPDIQLMLCEELAVIDNLSGKLYLIVYADPSK
PEAYPRAKQRLRELRAKLRHPVDVPVTSPSVRTDTVREFDKADYITAVLKAKEYIAAGDM
MQVQVGQRLVKPFRDAPLSLYRALRSLNPSPYMYFYNFGDMQIVGASPEILVRQEERRVQ
AGTPAGNGADESARIVTIRPLAGTRPRGNTPERDAELATELLNDPKEIAEHVMLIDLARN
DIGRIAEIGSIKVTDQMVIEKYSHVQHIVSSVEGRLKPGMTNMDVLRATFPAGTLSGAPK
VRAMEIIDELEPVKRGIYGGAVGYLSFSGEMDLAIAIRTGIIKDGNLYVQAAAGVVADSD
PDAEWRETEHKARAVLRAAEQVQDGLDADFS