Protein Info for RALBFv3_RS06145 in Ralstonia solanacearum IBSBF1503

Annotation: glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01027: glutamate 5-kinase
  • amino acids 11 to 372 (362 residues), 433.2 bits, E=4.1e-134
• PF00696: AA_kinase
  • amino acids 12 to 240 (229 residues), 159.6 bits, E=1.1e-50
• PF01472: PUA
  • amino acids 283 to 357 (75 residues), 78 bits, E=4.2e-26

Best Hits

Swiss-Prot: 97% identical to PROB_RALSO: Glutamate 5-kinase (proB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 99% identity to rsc:RCFBP_10641)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-citrulline biosynthesis (8/8 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-N^δ-acetylornithine biosynthesis (6/7 steps found)
• L-ornithine biosynthesis II (3/3 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Protein Sequence (374 amino acids)

>RALBFv3_RS06145 glutamate 5-kinase (Ralstonia solanacearum IBSBF1503)
MALRSLIADARRLVVKVGSSLVTNDGRGLDQAAIARWAAQIAALRGAGKEVVLVSSGAIA
EGMQRLGWAKRPKEIHELQAAAAVGQMGLAQVYESEFARHGIRTAQVLLTHGDLADRERY
LNARSTLLTLLSLGVVPIINENDTVVTDEIKFGDNDTLGALVTNLIEGDALIILTDQRGL
YTADPRKHPDARFVDEAQAGASELEAMAGGAGSSIGKGGMLTKILAAKRAAKSGAHTVIA
SGREADVLARLAGGEAIGTQLRAPTGRMAARKQWMIDHLQLRGRVVLDAGAVDKLTAGGK
SLLPIGVTEVQGEFARGEVISCVDTAGHEVARGLTNYSSAEARLIARKVSSEIETVLGYV
SAAELVHRDNLVLL