Protein Info for RALBFv3_RS06105 in Ralstonia solanacearum IBSBF1503

Annotation: signal recognition particle protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF02881: SRP54_N" amino acids 5 to 82 (78 residues), 66.2 bits, see alignment E=7.3e-22 TIGR00959: signal recognition particle protein" amino acids 110 to 450 (341 residues), 483.6 bits, see alignment E=2.6e-149 PF06414: Zeta_toxin" amino acids 118 to 163 (46 residues), 23.1 bits, see alignment 1.3e-08 PF00448: SRP54" amino acids 120 to 316 (197 residues), 243.1 bits, see alignment E=5.9e-76 PF13401: AAA_22" amino acids 121 to 230 (110 residues), 29.1 bits, see alignment E=3.3e-10 PF01656: CbiA" amino acids 127 to 275 (149 residues), 25.4 bits, see alignment E=3.5e-09 PF02978: SRP_SPB" amino acids 349 to 448 (100 residues), 113.1 bits, see alignment E=2e-36

Best Hits

KEGG orthology group: K03106, signal recognition particle subunit SRP54 (inferred from 99% identity to rsc:RCFBP_10649)

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>RALBFv3_RS06105 signal recognition particle protein (Ralstonia solanacearum IBSBF1503)
MLDNLTQRLARVVKTMRGEARLTEANTAEMLREVRLALLEADVALPVVREFIARVKEKAL
GEDVLTSLSPGQALVGIVQRELTAIIGGEEAVASAAPGPAGAPGLPMGRAAELNLNVQPP
AIILMAGLQGAGKTTTVGKLAKWLKENKKKKVLTVSCDVYRPAAIAQLKTVSEQVGADFF
PSQPDQKPVDIAAAALDWAKKHYHDVLIVDTAGRLGIDEAMMQEIAALHATLKPAETLFV
VDAMLGQDAVNTAKAFNDTLPLTGVVLTKLDGDARGGAALSVRHITGKPIKFVGVAEKLD
GLEPFYPDRMAQRILGMGDILALVEEAQRGVDMEQAQKLAAKIKKTGGFDLEDFKAQIGQ
MKKMGGLGSLIDKLPAQFAQQAQGANMDQADKQVRRMEGIINSMTPAERAKPELIKASRK
RRIAAGAGVPVQEVNRLLNQFEQMQTMMKKLKGGGMMKMMRAMGGLKGGMKGLLPGGR