Protein Info for RALBFv3_RS05715 in Ralstonia solanacearum IBSBF1503

Annotation: cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 106 to 134 (29 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 21 to 191 (171 residues), 120.6 bits, see alignment E=3.4e-39

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 98% identity to rsc:RCFBP_10731)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>RALBFv3_RS05715 cytochrome b (Ralstonia solanacearum IBSBF1503)
MPHAAPSDAALRAPAVDDGAYGKPAIALHWIIALLIFAAFGLGLYMTDIPGFTPTKLKLY
SYHKWVGITVLILAVLRVLWRLTHPAPAPVAGMPAWQQKAAEGAHIVLYLLILAVPLTGY
LLSVAAGIKVVYLGLWELPMPFDKSDALKEIFHEAHEWLNWTMATIVVLHILAALKHHIV
DRDGTLRRMLPFLR