Protein Info for RALBFv3_RS05680 in Ralstonia solanacearum IBSBF1503

Annotation: tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 310 to 327 (18 residues), see Phobius details TIGR00113: S-adenosylmethionine:tRNA ribosyltransferase-isomerase" amino acids 9 to 346 (338 residues), 425.9 bits, see alignment E=5.2e-132 PF02547: Queuosine_synth" amino acids 10 to 346 (337 residues), 436.3 bits, see alignment E=3.4e-135

Best Hits

Swiss-Prot: 97% identical to QUEA_RALSO: S-adenosylmethionine:tRNA ribosyltransferase-isomerase (queA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K07568, S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC: 5.-.-.-] (inferred from 98% identity to rsc:RCFBP_10738)

Predicted SEED Role

"S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC 5.-.-.-)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.-.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>RALBFv3_RS05680 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA (Ralstonia solanacearum IBSBF1503)
MSAPPLMLTLSDFDFDLPPELIAQTALPDRTASRLLAVHRDAPGTHFDDRQFADLVDYLR
PGDLLVFNDTRVIKARFFGHKASGGRIEVLVERLLDEHTVLAQIRSSKSPVAGSRLRLAD
AFDVTVGPRQEPFFTLRFPQPALELIEQYGRLPLPPYIEHTPDSFDETRYQTVYARTPGA
VAAPTAGLHFDDALFARLDAMGVRRGFLTLHVGAGTFSPVRVENIAEHRMHSEWYAISPE
LAEAIRATRAAGGRVIAVGTTSMRALESAAQPDGTLAAGSGETDIFITPGYRFRLVDALV
TNFHLPKSTLLMLVSAFAGLETIRAAYRHAIAQRYRFFSYGDAMFLTRAEPDTPSASPDP
SC