Protein Info for RALBFv3_RS05625 in Ralstonia solanacearum IBSBF1503

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF13404: HTH_AsnC-type" amino acids 3 to 44 (42 residues), 49.7 bits, see alignment E=1.1e-16 PF13412: HTH_24" amino acids 3 to 50 (48 residues), 64.6 bits, see alignment E=2e-21 PF01022: HTH_5" amino acids 8 to 50 (43 residues), 26.9 bits, see alignment E=1.5e-09 PF08279: HTH_11" amino acids 10 to 48 (39 residues), 27.1 bits, see alignment E=1.2e-09 PF01047: MarR" amino acids 10 to 50 (41 residues), 29.8 bits, see alignment E=1.8e-10 PF13545: HTH_Crp_2" amino acids 19 to 61 (43 residues), 27.4 bits, see alignment E=1.1e-09 PF01037: AsnC_trans_reg" amino acids 69 to 142 (74 residues), 55.4 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 45% identical to Y4TD_SINFN: Uncharacterized HTH-type transcriptional regulator y4tD (NGR_a01550) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_10748)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>RALBFv3_RS05625 Lrp/AsnC family transcriptional regulator (Ralstonia solanacearum IBSBF1503)
MELDSYDRKLLCLLQENNKLSQRDLADAVNLSASAVNRRIAALEEAGVIRANVSVVDAAA
LGRPITILVEVKLENERLDLLDEVCNRFVSRPEIQQVYYVTGDYDFLLVLNVRSMSEYEA
LTRELFLVSGNVKSFKTQVAMRRAKVTLNVAID