Protein Info for RALBFv3_RS05620 in Ralstonia solanacearum IBSBF1503

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01891: amidohydrolase
  • amino acids 13 to 376 (364 residues), 354.7 bits, E=3.1e-110
• PF01546: Peptidase_M20
  • amino acids 72 to 385 (314 residues), 149.7 bits, E=1.1e-47
• PF07687: M20_dimer
  • amino acids 186 to 277 (92 residues), 23.4 bits, E=4.9e-09

Best Hits

Swiss-Prot: 38% identical to YHAA_BACSU: Putative amidohydrolase YhaA (yhaA) from Bacillus subtilis (strain 168)

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 97% identity to rsc:RCFBP_10749)

MetaCyc: 38% identical to N-acetyl amino acid acetylase (Bacillus subtilis subtilis 168)
3.5.1.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

MetaCyc Pathways

• S-(2-succinyl)-L-cysteine degradation (2/4 steps found)
• S-benzyl-L-cysteine degradation (1/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Protein Sequence (400 amino acids)

>RALBFv3_RS05620 amidohydrolase (Ralstonia solanacearum IBSBF1503)
MSTHSELELHSQMAQWRHHLHQHPETGFEEKLTSDYVAKALQDMGLEVHRGIGGTGLVAN
LTVGTGGRAVGIRADMDALNITENAGCRAHASSIPGKMHACGHDGHMAMVLGAARLLSER
RDFRGTVRFVFQPAEEHGRGAKAMMADGLFDRFPVDALFGAHNMPGLPAGAIATRVGGIM
ASEDNFVIRIKGRGTHAARPHMGADPLVIGAEIVLALQTVVSRNVDPSQPAVVSCTEFIT
DGIRNAIPSHVVIKGDTRSYSPDVQTLLENRMRAICEGICRAHQAECTFEYTHEFAPTVN
WPACVPVAVSAARRVVGESRVMAEIAPMMISEDFGAFLTKVPGAFVFIGNGATGEAGSVP
LHNSAYDFNDAVLSTGAAYFYEVAKAALDSDVDFAREQPE