Protein Info for RALBFv3_RS05360 in Ralstonia solanacearum IBSBF1503

Annotation: nucleotide exchange factor GrpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF01025: GrpE" amino acids 58 to 211 (154 residues), 156.9 bits, see alignment E=1.9e-50

Best Hits

Swiss-Prot: 94% identical to GRPE_RALSO: Protein GrpE (grpE) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03687, molecular chaperone GrpE (inferred from 98% identity to rsc:RCFBP_10808)

Predicted SEED Role

"Heat shock protein GrpE" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>RALBFv3_RS05360 nucleotide exchange factor GrpE (Ralstonia solanacearum IBSBF1503)
MKHTSEPTSQPDTQAAESAQPSAAAAGQAASAYSSQAQRASAEAQAIAGDEAAVAEAVVE
QDTAELRRQLDVAEEKARQNYENWARAVAEGENIRRRAQDDVARAHKFAIEGFAEYLLPV
MDSLQAALTDTSGDTAKLREGVELTLKQLYAAFEKGRVAELNPVGEKFDPHRHQAISMVP
ADQEANTVVNVLQRGYALADRVLRPALVTVAAPK