Protein Info for RALBFv3_RS05185 in Ralstonia solanacearum IBSBF1503
Annotation: ornithine carbamoyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to OTC_RALPJ: Ornithine carbamoyltransferase (arcB) from Ralstonia pickettii (strain 12J)
KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_10844)MetaCyc: 43% identical to ornithine carbamoyltransferase (Arabidopsis thaliana col)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]
Predicted SEED Role
"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)
MetaCyc Pathways
- superpathway of arginine and polyamine biosynthesis (16/17 steps found)
- L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
- L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
- L-citrulline biosynthesis (8/8 steps found)
- superpathway of L-citrulline metabolism (10/12 steps found)
- L-citrulline degradation (3/3 steps found)
- L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
- urea cycle (4/5 steps found)
- L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
- L-arginine biosynthesis IV (archaea) (4/9 steps found)
- L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.1.3.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (308 amino acids)
>RALBFv3_RS05185 ornithine carbamoyltransferase (Ralstonia solanacearum IBSBF1503) MNPPSKIKHYLQFKDFSLEEYEYLLDRSRILKAKFKNYETWHPLHDRTLAMIFEKNSTRT RLSFEAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMTDIIMIRTFGQEIIERFAA HSRVPVINGLTNEYHPCQVLADIFTFIEQRGSIKGKTVTWVGDANNMAYTWIQAAEILGF RFHFSAPKGYQLDPAMVADSSRPFVHVFENPLEACDGAHLVTTDVWTSMGYEAENEARKK AFGDWMVTEAMMQRAQPDALFMHCLPAHRGEEVEAAVIDGKQSVVWDEAENRLHVQKALM EYLLCGRY