Protein Info for RALBFv3_RS05180 in Ralstonia solanacearum IBSBF1503

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR00032: argininosuccinate synthase" amino acids 13 to 420 (408 residues), 523.8 bits, see alignment E=1.8e-161 PF00764: Arginosuc_synth" amino acids 13 to 160 (148 residues), 70.2 bits, see alignment E=2.2e-23 PF20979: Arginosuc_syn_C" amino acids 191 to 404 (214 residues), 113.6 bits, see alignment E=1.1e-36

Best Hits

Swiss-Prot: 99% identical to ASSY_RALSO: Argininosuccinate synthase (argG) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 99% identity to rsc:RCFBP_10845)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>RALBFv3_RS05180 argininosuccinate synthase (Ralstonia solanacearum IBSBF1503)
METILQHVPVGQKVGIAFSGGLDTSAALRWMKNKGALPYAYTANLGQPDEEDYDAIPRKA
MEYGAEKARLIDCRPQLANEGIAAIQAGAFHISTGGITYFNTTPLGRAVTGTMLVAAMKE
DDVHIWGDGSTFKGNDIERFYRYGLLTNPALKIYKPWLDQTFIDELGGRAEMSAFMTREG
FGYKMSAEKAYSTDSNMLGATHEAKDLEHLNSGIRIVNPIMGVAFWKPEVEVKAEEVSIT
FDEGRPVAVNGREIADPVEMFLELNRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALL
HLAYERLVTGIHNEDTIEQYRINGLRLGRLLYQGRWFDPQAIMLRETAQRWVARAVTGTV
TLELRRGNDYSILNTESPNLTYAPERLSMEKVEDAPFSPADRIGQLTMRNLDLMDTRDKL
AIYAKAGLLSLGTSSALPQLGGNGK