Protein Info for RALBFv3_RS04950 in Ralstonia solanacearum IBSBF1503

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details PF00892: EamA" amino acids 9 to 136 (128 residues), 75.2 bits, see alignment E=2.9e-25 amino acids 150 to 281 (132 residues), 73.1 bits, see alignment E=1.3e-24

Best Hits

KEGG orthology group: None (inferred from 96% identity to rsc:RCFBP_10891)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>RALBFv3_RS04950 EamA/RhaT family transporter (Ralstonia solanacearum IBSBF1503)
MRRSDVIELLTLAALWGGSFLFMRVAAPLFGPVALIALRVAIASAFLLPVLAMRGGLGVL
RAQWPHLLAVGILNSAIPFCLFAYAELTLTAGFTSVLNAAAPLFAAIVAFVWLGERMSSW
RVLGLAIGFVGVIVLVGGSSALDAGQGGLAVAAALGATVLYGLASSYTKRHLTGVPPLAV
ATGSQVAAAIVLAPLAVWLWPAHTPTGSVWFHVIGLGIACTGIAYILFFRLVAHVGPTRA
VSVTFLIPVFGVLWGILFLDEPLTLNMVAGCAVILLGTSLSTGVLAPGKRANASAGSGAS
NKDSLLRPDR