Protein Info for RALBFv3_RS04800 in Ralstonia solanacearum IBSBF1503

Annotation: LLM class flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR03558: luciferase family oxidoreductase, group 1" amino acids 9 to 333 (325 residues), 389 bits, see alignment E=8.8e-121 PF00296: Bac_luciferase" amino acids 21 to 307 (287 residues), 110.2 bits, see alignment E=6.8e-36

Best Hits

Swiss-Prot: 44% identical to YCEB_BACSU: Uncharacterized protein YceB (yceB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_10963)

Predicted SEED Role

"Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>RALBFv3_RS04800 LLM class flavin-dependent oxidoreductase (Ralstonia solanacearum IBSBF1503)
MSSDTAVRLSILDQSPVIHGHSARDAIAATVDLAQMADALGYTRYWCAEHHGLRSVSNPA
PEVMIARVASATRHLRVGSGGVMLPYYSPFKLAEQFRLLEALFPNRIDLGVGRAPGGDMR
TAQAVAMGDYNRGDRFPQQVQELIWHLSGTLPPDHPAYGVILQPEIDTRPELWMLGSSDF
GGALAAQLGIRFAFAHFINPHVGHIVAQQYRTDFAPGFEPRPYSAAAVFVIAADTEAQAR
RCEAAIDLRRVQMALGVNGPIPTIEQAEAHIHTERDQAIIARERPRSLIGTPESVAEQML
ALKERFVADELIVLTVAPSYQARMRSYELLAQAFALPSPASATQSSACSA