Protein Info for RALBFv3_RS04725 in Ralstonia solanacearum IBSBF1503

Annotation: L-aspartate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00551: L-aspartate oxidase" amino acids 2 to 511 (510 residues), 671.6 bits, see alignment E=3.2e-206 PF01266: DAO" amino acids 4 to 102 (99 residues), 38.6 bits, see alignment E=1.9e-13 PF00890: FAD_binding_2" amino acids 4 to 383 (380 residues), 352.8 bits, see alignment E=6.4e-109 PF02910: Succ_DH_flav_C" amino acids 432 to 512 (81 residues), 58.3 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 96% identical to NADB1_RALSO: L-aspartate oxidase 1 (nadB1) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00278, L-aspartate oxidase [EC: 1.4.3.16] (inferred from 99% identity to rsc:RCFBP_10979)

MetaCyc: 60% identical to L-aspartate oxidase (Escherichia coli K-12 substr. MG1655)
1.5.98.-; L-aspartate oxidase. [EC: 1.4.3.16]

Predicted SEED Role

"L-aspartate oxidase (EC 1.4.3.16)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 1.4.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.16

Use Curated BLAST to search for 1.4.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>RALBFv3_RS04725 L-aspartate oxidase (Ralstonia solanacearum IBSBF1503)
MNFDVAVVGSGLAGLTVALHLADHRRVVVISKRTLPEGASDWAQGGIAAVLDSNDSHDEH
VDDTLIAGAGLCDEAATRYIVENGRAAIEWLIGHGVPFTRDEQAELGFHLTREGGHRHRR
IIHAADATGHAVVSTLVDKVRTHPNITLLEDHFAIDLVTDAKLGLPGMRCHGLYVLDGKS
GDVKTITAGQTVLATGGAGKVYLYTTNPDTATGDGIAMAWRAGCRVANMEFIQFHPTCLY
HPFAKSFLISEAVRGEGGKLILPDGTRFMPAHDARAELAPRDIVARAIDFEMKKRGLDCV
YLDISHQSPAFLKEHFPTILARCLELGIDITRQPIPVVPAAHYTCGGVVTDQLGRTDIAG
LYAVGETAYTGLHGANRLASNSLLECMVIGRGAAEDILGQPATALTSAQVPAWDESRVTD
ADEEVVVSHNWDELRRMMWNYVGIVRTNKRLERAQHRIALLREEIAEYYANFRVGHDLLE
LRNLVEVASLIVDSALSRHESRGLHFSRDYPQTLPKALPTVMQPAHRRTSRQH