Protein Info for RALBFv3_RS04630 in Ralstonia solanacearum IBSBF1503

Annotation: cytochrome c4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 29 to 105 (77 residues), 25.3 bits, see alignment E=2.4e-09 amino acids 123 to 203 (81 residues), 30.9 bits, see alignment E=4.1e-11 PF00034: Cytochrom_C" amino acids 29 to 105 (77 residues), 30.9 bits, see alignment E=8.4e-11 amino acids 123 to 204 (82 residues), 38.5 bits, see alignment E=3.7e-13

Best Hits

KEGG orthology group: None (inferred from 91% identity to rso:RSc0197)

Predicted SEED Role

"Cytochrome c4" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>RALBFv3_RS04630 cytochrome c4 (Ralstonia solanacearum IBSBF1503)
MKRLHQPGRIWLAGVAALAAIGGSVAVGAQDGEKLAAQLCSSCHGVHGKSESPMFPRLDA
QVPHYMEAQLKGFRDRGRGETDAQAFMWGIASQLDDATIASLAEYYARQTAPAGPAGDPA
LMARGKEIFEHGLPAEGVPACASCHGAHAEGNDTFPRLAGQHEAYLLRQISVFKNGTRAN
APVMSAVAHTLTDEQAKAVAAFLQAQ