Protein Info for RALBFv3_RS04165 in Ralstonia solanacearum IBSBF1503

Annotation: thioredoxin-disulfide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01292: thioredoxin-disulfide reductase" amino acids 6 to 319 (314 residues), 384.8 bits, see alignment E=1e-119 PF07992: Pyr_redox_2" amino acids 6 to 307 (302 residues), 165.5 bits, see alignment E=5e-52 PF13738: Pyr_redox_3" amino acids 54 to 291 (238 residues), 56.1 bits, see alignment E=9.3e-19 PF00070: Pyr_redox" amino acids 147 to 222 (76 residues), 59 bits, see alignment E=1.4e-19

Best Hits

Swiss-Prot: 65% identical to TRXB_COXBU: Thioredoxin reductase (trxB) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 99% identity to rsc:RCFBP_11090)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>RALBFv3_RS04165 thioredoxin-disulfide reductase (Ralstonia solanacearum IBSBF1503)
MAKHAKVLILGSGPAGYTAAIYAARANLNPMLITGLAQGGQLMTTTDVENWPADKEGLQG
PELMQRFLEHAERFSTEVVFDHIHTAQLAEKPIRLVGDSGEYTCDALIISTGASAQYLGL
PSEETFSGRGVSACATCDGFFYKGQEVAVVGGGNTAVEEALYLANIATKVTLIHRRDKFR
AEPILVDRLLEQQKKGKIEIKYNTVLDEVLGDDSGVTGVRLRGVNGNHIGGNPDGTEELK
LAGVFIAIGHKPNTDLFKGQLDMNETGYLRTQSGLTGNATATNIPGVFAAGDVQDHIYRQ
AITSAGTGCMAALDAQRYLENLE