Protein Info for RALBFv3_RS03765 in Ralstonia solanacearum IBSBF1503

Annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR00938: homoserine kinase" amino acids 1 to 317 (317 residues), 313.3 bits, see alignment E=8.8e-98 PF01636: APH" amino acids 27 to 268 (242 residues), 147.8 bits, see alignment E=2.4e-47

Best Hits

Swiss-Prot: 94% identical to KHSE_RALSO: Homoserine kinase (thrB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02204, homoserine kinase type II [EC: 2.7.1.39] (inferred from 98% identity to rsc:RCFBP_11159)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>RALBFv3_RS03765 homoserine kinase (Ralstonia solanacearum IBSBF1503)
MAVFTPVTDAEIALWLEQYDVGTVRALRGIPSGIENTNFLLTTEKDGAAHDYVVTVFERL
AHEQLPFYLYLMQHLAQHGICVPAPIPGRDGAILRTLKGKPATIVTRLPGRSNLAPTADE
CAIVGDMLARMHLAGRDYPRHQPNLRSLPWWNEVVPDILPFVEGATRELLVAELAHQQRF
FAGADYAALPEGPCHCDLFRDNVLFEPAADGQPERLGGFFDFYFAGVDKWLFDVAVTVND
WCVDLATGALDAARARAMLRAYHAVRPFTDAEARHWQDMLRAAAYRFWVSRLWDFHLPRD
AELLQPHDPTHFERVLRERVRVEGLTLDIPEPCN