Protein Info for RALBFv3_RS03615 in Ralstonia solanacearum IBSBF1503

Annotation: ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 213 to 229 (17 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 340 to 365 (26 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details amino acids 405 to 425 (21 residues), see Phobius details PF04932: Wzy_C" amino acids 198 to 352 (155 residues), 73.5 bits, see alignment E=8.2e-25

Best Hits

KEGG orthology group: None (inferred from 97% identity to rsc:RCFBP_11191)

Predicted SEED Role

"FIG01270238: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>RALBFv3_RS03615 ligase (Ralstonia solanacearum IBSBF1503)
MMNWSDKHSGRTDLWYAPLAVFLLIYPVLTVIKQGGASALLIAAGVLSLGAGVAVRRVLS
GPATPYGADRLVRLTGWALCAPLVAVILSEAWHGQLRWNAFDAPARFLAAVPLFLLLRRA
PLRWLRWADGSFAVAALAGLGVCLWAARDWGEGRMGSAFLNPIHFGDIALVLGVLSALSI
NWWRKDPLAVRLLKIGGLLAGLVASLLTGSRGGWVALPFILMLVVIARGRDKPARWRVLV
PAAAVLGVVALYIVSGTIRERIHMVWADLAQYGQGQKDTSVGIRLQIYQAALMLIPQHPI
FGLGPGGFADSLQALVDAGRMTATAAQLGRGEAHNQLLAYTANFGLVGGLAIVAIHLVPG
LLCWRCLKAPAAPMRRAALMGAVFALAFFVFGLTVEIFTLKMTASFYAAVIACLAGIASH
TGPAAEAGTSSPTER