Protein Info for RALBFv3_RS03345 in Ralstonia solanacearum IBSBF1503

Annotation: ribonuclease PH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR01966: ribonuclease PH" amino acids 2 to 236 (235 residues), 394.5 bits, see alignment E=6.3e-123 PF01138: RNase_PH" amino acids 10 to 140 (131 residues), 90 bits, see alignment E=1.8e-29 PF03725: RNase_PH_C" amino acids 157 to 221 (65 residues), 55.3 bits, see alignment E=5.2e-19

Best Hits

Swiss-Prot: 95% identical to RNPH_RALSO: Ribonuclease PH (rph) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00989, ribonuclease PH [EC: 2.7.7.56] (inferred from 100% identity to rsc:RCFBP_11255)

Predicted SEED Role

"Ribonuclease PH (EC 2.7.7.56)" in subsystem Heat shock dnaK gene cluster extended or tRNA processing (EC 2.7.7.56)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>RALBFv3_RS03345 ribonuclease PH (Ralstonia solanacearum IBSBF1503)
MRPSGRQPDQLRSVTLTRHYTRHAEGSVLVCFGDTHVLCTASVLPKVPPHKKGSGEGWVT
AEYGMLPRSTHTRSDREAARGKQSGRTQEIQRLIGRAMRSVFDLSALGEHTLHLDCDVLQ
ADGGTRTASITGAFVAAYDAVSVMRGKGLLAGEPIRDFVAAVSVGVVDGVPVLDLDYPED
SACDTDMNVVMTGNGGFVEVQGTAEGTPFTRTEMDALLGLADQGIRTLIGLQKQALGL