Protein Info for RALBFv3_RS03250 in Ralstonia solanacearum IBSBF1503

Annotation: OHCU decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF09349: OHCU_decarbox" amino acids 12 to 167 (156 residues), 181.9 bits, see alignment E=6.4e-58 TIGR03164: OHCU decarboxylase" amino acids 14 to 170 (157 residues), 213.8 bits, see alignment E=6.9e-68

Best Hits

Swiss-Prot: 46% identical to URAD_HALVD: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (HVO_B0301) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: None (inferred from 96% identity to rsc:RCFBP_11273)

Predicted SEED Role

"Urate oxidase (EC 1.7.3.3)" (EC 1.7.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.3.3

Use Curated BLAST to search for 1.7.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>RALBFv3_RS03250 OHCU decarboxylase (Ralstonia solanacearum IBSBF1503)
MIQTTYTLAQLNAMDAAQFVQALGGIYEHSPWVAVRAAGQRPFASADALAAAMRHAVDGA
GEGPQLELVRAHPELAGKAAVRGELTAESTREQAGAGLDQCSPEEFARLQALNARYHDQF
GFPFILAVRGYDRHGIIDAFARRVEHDRDTELRASLEQIHRIAGFRLHDLISG