Protein Info for RALBFv3_RS03155 in Ralstonia solanacearum IBSBF1503

Annotation: adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01430: adenosine deaminase
  • amino acids 15 to 337 (323 residues), 371.8 bits, E=1.4e-115
• PF00962: A_deaminase
  • amino acids 15 to 339 (325 residues), 292.3 bits, E=4.6e-91
• PF19326: AMP_deaminase
  • amino acids 201 to 335 (135 residues), 27.4 bits, E=1.2e-10

Best Hits

Swiss-Prot: 96% identical to ADE_RALPJ: Adenine deaminase (Rpic_2249) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 98% identity to rsc:RCFBP_11291)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

• adenosine nucleotides degradation II (4/5 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• adenine and adenosine salvage III (2/4 steps found)
• adenine and adenosine salvage V (1/3 steps found)
• purine deoxyribonucleosides degradation II (1/3 steps found)
• purine deoxyribonucleosides degradation I (1/4 steps found)
• purine ribonucleosides degradation (1/6 steps found)
• superpathway of purine deoxyribonucleosides degradation (1/7 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Protein Sequence (345 amino acids)

>RALBFv3_RS03155 adenosine deaminase (Ralstonia solanacearum IBSBF1503)
MPISPALAERIATSPKAELHIHIEGSLEPELMFALAERNGVKLPYASVEAVRAAYAFDDL
QSFLDLYYAGASVLLTEQDFYDMTAAYVARAVADNVRHAEIFFDPQTHTARDVPMHVVIG
GIVRALDDAERAHGFSSRLILCFLRHLSEEDAFDTLEAALPYIQDPANRIIGVGLDSSER
GNPPEKFARVFARCKELGLRLVAHAGEEGPAQYVIDALDILGVERIDHGVRAIDDAALVK
RLAASRVALTMCPLSNEKLKVYPDLRDHSLKQLLDAGCAVTLHSDDPAYFGGYMNTNWLA
TFNALDLSAADAHALARNSFEAAFLPEQDKALWLARVDDHWKATH