Protein Info for RALBFv3_RS03090 in Ralstonia solanacearum IBSBF1503

Annotation: diacylglycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 59 to 76 (18 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details PF01219: DAGK_prokar" amino acids 40 to 140 (101 residues), 108.3 bits, see alignment E=8.2e-36

Best Hits

KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 99% identity to rsc:RCFBP_11304)

Predicted SEED Role

"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>RALBFv3_RS03090 diacylglycerol kinase (Ralstonia solanacearum IBSBF1503)
MKPTTPPERPTPPSTAGAYSPADNPHKGNRGLTRAWFALKHSISGIRFAIDEESAFRQEL
TLCAILLPCAFVIPATVVERILMIGTLVLVLIVELLNSSVEAAVDRISLEQHGLSKRAKD
FGSAAVLMALLLCAGTWVAIAWPWVASLLR