Protein Info for RALBFv3_RS03030 in Ralstonia solanacearum IBSBF1503

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01066: CDP-OH_P_transf
  • amino acids 47 to 205 (159 residues), 73.4 bits, E=1.4e-24
• TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase
  • amino acids 55 to 191 (137 residues), 111.7 bits, E=1.7e-36

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 99% identity to rsc:RCFBP_11316)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Protein Sequence (291 amino acids)

>RALBFv3_RS03030 CDP-diacylglycerol--serine O-phosphatidyltransferase (Ralstonia solanacearum IBSBF1503)
MPAFNRRKKRFTASNVMHLRPLRHNQPRSDDDELEAVRPRRRRGIYLLPNAFTTAALFAG
FFAIVQAMNLNFETAAIAIFAAMVLDGMDGRVARITNTQSAFGEQYDSLSDMCSFGVAPA
LVMYEWILRDLGKWGWLAAFVYCAGAALRLARFNTNIGVVDKRFFQGMPSPAAAALIAGF
VWLAIDNKLPVKELWMPWVAFGLTLYAGLSMVSNAPFYSGKALDVRHRVPFGVMVLVLVL
FVVVSSDPPVALFGLFVGYAVSGYLLWGWRTVHGQAGSPRLPRDTAPDADE