Protein Info for RALBFv3_RS02440 in Ralstonia solanacearum IBSBF1503

Annotation: cation acetate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details amino acids 507 to 533 (27 residues), see Phobius details amino acids 553 to 571 (19 residues), see Phobius details amino acids 577 to 601 (25 residues), see Phobius details amino acids 609 to 629 (21 residues), see Phobius details amino acids 649 to 669 (21 residues), see Phobius details TIGR03648: probable sodium:solute symporter, VC_2705 subfamily" amino acids 49 to 687 (639 residues), 707.4 bits, see alignment E=5.6e-217 PF00474: SSF" amino acids 74 to 237 (164 residues), 108 bits, see alignment E=2.7e-35 amino acids 502 to 617 (116 residues), 77.2 bits, see alignment E=6.2e-26

Best Hits

Swiss-Prot: 76% identical to Y2524_CUPNH: Uncharacterized symporter H16_A2524 (H16_A2524) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K14393, cation/acetate symporter (inferred from 98% identity to rsc:RCFBP_11433)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (688 amino acids)

>RALBFv3_RS02440 cation acetate symporter (Ralstonia solanacearum IBSBF1503)
MAATDVSADSRLRKRLFVYYGLYTVGLLLFIVMMGAIERVRGPGVWLGYVFLFITIAIYA
CIGLICRTADLTEYYVAGRRVPAFFNGMATAADWMSAASFIGLAGIVFASGYEGLAYVMG
WTGGYCLVAFLLAPYLRKFGGYTVPDFLATRYGNGERGGSAVVRGIAVLGATLCSFVYLV
AQIQGVGLVVTRFIGVEFAVGVFFGLAGILVCSFLGGMRAVTWTQVAQYIILIVSFLGVV
AMIGWHRYHDPVPQLSTGRLLQQIEAAEQRIAHDPAEQAVRDHFLAEAQALQDRIARLPP
SFDETREALNAQLKRARERNAPLREIKALERAREAFPPDAATAAILWNQQREEALARSRV
APPSTEPFPSASEAERGRQRLNFVLLVFCLMVGTASLPHILTRFHTTPSVRETRNSVGWT
LFFIVLLYVSAPALAALVKLDLLQHLVGTPFADLPQWIVPWRKVDPPVFALRDINGDGIV
QWAEVMIQPDMIVLAAPEIAGLPYVMSGLIAAGALAAALSTADGLLLTIANALSHDVYFH
MIDNSASHQRRVTGAKVVLLGVALLAAYVTSLKPGNILFLVGAAFSLAASCFFPVLVLGV
FWKRTNRAGAIAGMLTGLAVSVYYISVNYPFFTRMTGILGQPWFGVDPIASGAFGVPAGF
AAAVIVSLLTRPNRPVVDRLVGYLRDPL