Protein Info for RALBFv3_RS02210 in Ralstonia solanacearum IBSBF1503

Annotation: lytic transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01464: SLT" amino acids 111 to 217 (107 residues), 97.1 bits, see alignment E=5.2e-32 PF01476: LysM" amino acids 336 to 378 (43 residues), 15.5 bits, see alignment 1.4e-06 amino acids 419 to 447 (29 residues), 28.5 bits, see alignment (E = 1.2e-10)

Best Hits

KEGG orthology group: K08307, membrane-bound lytic murein transglycosylase D [EC: 3.2.1.-] (inferred from 99% identity to rsc:RCFBP_11495)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (510 amino acids)

>RALBFv3_RS02210 lytic transglycosylase (Ralstonia solanacearum IBSBF1503)
MRSVRLLAASVFSLLLAACATAPAPNADTASTSAVSSSSGNDGPVVNVDQQPVASLKGPA
KDLWARIRQGFSMPDLQSSAVDDRADWYAQRPEAFRRMVDRSNRYLYHIVEELERRNMPT
ELALLPFVESAFNPQAVSSAKAAGMWQFIPSTGKTYNLRQNVFQDERRDVLASTDAALDY
LSKLHDQFGDWQLALAAYNWGEGAVARAIARNQAAGQSTDYLNLNMPAETRMYVPKLQAI
KNIITNPERYGIALPDIPNHPYFVTVTTSRDIDVSLAARLANLPLDEFKALNPSFNRPVI
LGASNPQILLPYDNAETFQYNLNTYHGGLSSWTAVTVGNRERVEALAARLKVDPDTIREI
NRIPKGMRLKAGSTVVVPRAEDAKEDAPDISPELAENAIMAVEPDVPDLRRVVVRAGKQD
TLAGLSRRYGVSVAQLRAWNQLSGDAIPRGHNVVLMLPQARSGGHVRAVRVSAASRPAAA
AVRAPVAKVAGKPVARAKPLAGAAAKRRKH