Protein Info for RALBFv3_RS01635 in Ralstonia solanacearum IBSBF1503

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 263 to 280 (18 residues), see Phobius details amino acids 286 to 303 (18 residues), see Phobius details PF00892: EamA" amino acids 24 to 157 (134 residues), 43.9 bits, see alignment E=1.5e-15 amino acids 173 to 303 (131 residues), 43.4 bits, see alignment E=2.2e-15

Best Hits

KEGG orthology group: None (inferred from 97% identity to rsc:RCFBP_11613)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>RALBFv3_RS01635 EamA/RhaT family transporter (Ralstonia solanacearum IBSBF1503)
MTQAYSAARMPARDSLFVAAMPWLFVLIWSTGFIVAKFGMPYAEPITFLFLRFVGVLVCL
LSLVWVARVPLPRHAGTNDVDWPTIGHLVVAGVLMQWGYLGGVWVAIKLGMPAGMSALIV
GMQPILTALYVSMRGERVSSRQWLGLLFGIAGVGLVVANKLHLAGVNVTTLGFCLGALLS
ITAGTLYQKRFCPVFDLRMGACIQFGASALLCLPFMFAFETREVQWTGPMIGALVWSVLA
LSIGAISLLFMLIRHGAATKVTSLLYLTPPTTAVMAWALFGERFPQLAALGMVIAACGVA
LVIRK