Protein Info for RALBFv3_RS01615 in Ralstonia solanacearum IBSBF1503

Annotation: IclR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF09339: HTH_IclR" amino acids 16 to 64 (49 residues), 53.2 bits, see alignment 3e-18 PF01614: IclR" amino acids 131 to 251 (121 residues), 109.8 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 33% identical to KIPR_BACSU: HTH-type transcriptional regulator KipR (kipR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_11617)

Predicted SEED Role

"Predicted Lactate-responsive regulator, IclR family" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>RALBFv3_RS01615 IclR family transcriptional regulator (Ralstonia solanacearum IBSBF1503)
MAEADKDPGKTSIQVIERMMLLLDALASHADPVSLKALSTNTGLHPSTAHRILNDMVACR
FVDRSDPGSYRLGMRLLELGNLVKARLSVREAALVPMRALHRLTGQTVNLSVRQGDEIVY
IERAYSERSGMQVVRAIGGRAPLHLTSVGKLFLAADEIGRVRAYATRTGLSGHTRTSITD
LPKLERELNWVRTNGYARDNEELELGVRCIAAGIYDDSRHLVAGLSLSAPADRLQDSWLE
NLKDTALQISRGMGFIPEEQPVRAE