Protein Info for RALBFv3_RS01005 in Ralstonia solanacearum IBSBF1503

Annotation: ankyrin repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF12796: Ank_2" amino acids 38 to 128 (91 residues), 43.2 bits, see alignment E=1.2e-14 amino acids 103 to 193 (91 residues), 83 bits, see alignment E=4.5e-27 PF13637: Ank_4" amino acids 70 to 117 (48 residues), 24.1 bits, see alignment 9.3e-09 amino acids 112 to 150 (39 residues), 25.7 bits, see alignment 2.9e-09 PF00023: Ank" amino acids 130 to 158 (29 residues), 32.4 bits, see alignment (E = 1.8e-11) amino acids 162 to 193 (32 residues), 32.1 bits, see alignment 2.3e-11 PF13606: Ank_3" amino acids 130 to 157 (28 residues), 28.4 bits, see alignment (E = 3.1e-10)

Best Hits

KEGG orthology group: K06867, (no description) (inferred from 97% identity to rsc:RCFBP_11793)

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>RALBFv3_RS01005 ankyrin repeat domain-containing protein (Ralstonia solanacearum IBSBF1503)
MRYRDNLKRNLKQSALAAGLLMTLSCAVRATPQDDLRNAVEYNRPALVQKFVAQGVDPNL
NTRDGTPLLVDALKDGNTDVAEALIRAKGIDFERTNAAGENALMMAAYQGLLPLVRLMIE
TYEVEVNKTGWTALHYAATNGHDAIVKYLLDHAAYIDAESPNGTTPLMMATMSGHITTVK
LLLDEGADMNLRNQQKMDVIDFAKRYHQDEIAAGLESRRRKLAEPGAQPAPARPPAAPAV
PAPAVPDTPAPTPAPRPPEHAVDRDATSGLPGSLSDQKTIPPPDLRGN