Protein Info for RALBFv3_RS00575 in Ralstonia solanacearum IBSBF1503

Annotation: protocatechuate 3,4-dioxygenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02423: protocatechuate 3,4-dioxygenase, alpha subunit
  • amino acids 31 to 232 (202 residues), 242.1 bits, E=2.2e-76
• PF00775: Dioxygenase_C
  • amino acids 67 to 218 (152 residues), 63.7 bits, E=7.8e-22

Best Hits

Swiss-Prot: 62% identical to PCXA_ACIAD: Protocatechuate 3,4-dioxygenase alpha chain (pcaG) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K00448, protocatechuate 3,4-dioxygenase, alpha subunit [EC: 1.13.11.3] (inferred from 98% identity to rsc:RCFBP_11907)

MetaCyc: 50% identical to protocatechuate 3,4-dioxygenase alpha subunit (Pseudomonas putida)
Protocatechuate 3,4-dioxygenase. [EC: 1.13.11.3]; 1.13.11.- [EC: 1.13.11.3]

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase alpha chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• gallate degradation II (3/5 steps found)
• 4-sulfocatechol degradation (2/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (17/35 steps found)
• superpathway of aerobic toluene degradation (10/30 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.3

Use Curated BLAST to search for 1.13.11.3

Protein Sequence (232 amino acids)

>RALBFv3_RS00575 protocatechuate 3,4-dioxygenase subunit alpha (Ralstonia solanacearum IBSBF1503)
MMTMTTLRESLERAQATAPTTTPPFVHYDETASQTGGPYVHIGLAPRQAGFDIYEKAFGN
VLTTPATRGERIQLEGRVYDGSGTLVRDVLIEIWQANADGKYAHPGDRQDKPVDPAFRGW
GRTGADFETGVYRFETIKPGPVAGRGDSVQAPHICMVLFARGINLGLHTRVYFSDEAEAN
SRDPVLTGIEWEVRRQTLIARRGERNGAVVYTFDVRLQDTPDGGAETVFFDI