Protein Info for RALBFv3_RS00405 in Ralstonia solanacearum IBSBF1503

Annotation: 1-deoxy-D-xylulose-5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase" amino acids 2 to 386 (385 residues), 515.2 bits, see alignment E=5.3e-159 PF02670: DXP_reductoisom" amino acids 4 to 132 (129 residues), 157.7 bits, see alignment E=3.8e-50 PF08436: DXP_redisom_C" amino acids 146 to 232 (87 residues), 133.1 bits, see alignment E=4.9e-43 PF13288: DXPR_C" amino acids 264 to 380 (117 residues), 144.5 bits, see alignment E=2.4e-46

Best Hits

Swiss-Prot: 95% identical to DXR_RALSO: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 98% identity to rsc:RCFBP_20023)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>RALBFv3_RS00405 1-deoxy-D-xylulose-5-phosphate reductoisomerase (Ralstonia solanacearum IBSBF1503)
MMRITVLGATGSIGDSTLDVVRRHPDRYRVFALTANAQVDKLAALCRDFHPAMAVVGSAA
AAAALRDQLGAEAAGIDIRFGPEALEEAAAHPDCDAVMAAIVGAAGLRPTLAAVRAGKRV
LLANKEALVMSGALFMDAVRQHGATVLPIDSEHNAIFQCLPQQRPQFGHGVARIVLTASG
GPFRARAIETLTEVTPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFNVPVAQLE
VLIHPQSVIHSMVAYDDGSVLAQLGNPDMRTPIAYGLAYPDRIEAGVPLLDLAATGTLAF
EAPDLHRFPCLALAFDALRAGGTAPAVLNAANEVAVEAFLQRRIRFTEIAAVVDDTLART
AIGPADSLDTVFAADAQARRRAEHYIAASCIHS