Protein Info for RALBFv3_RS00165 in Ralstonia solanacearum IBSBF1503

Annotation: haloacid dehalogenase type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00702: Hydrolase" amino acids 4 to 186 (183 residues), 74.3 bits, see alignment E=1.8e-24 TIGR01428: haloacid dehalogenase, type II" amino acids 4 to 204 (201 residues), 239.6 bits, see alignment E=3e-75 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 6 to 189 (184 residues), 88.4 bits, see alignment E=6.2e-29 PF13419: HAD_2" amino acids 98 to 194 (97 residues), 33.4 bits, see alignment E=4.9e-12

Best Hits

Swiss-Prot: 50% identical to HAD_AGRTR: 2-haloalkanoic acid dehalogenase from Agrobacterium tumefaciens (strain RS5)

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 99% identity to rsc:RCFBP_20068)

MetaCyc: 46% identical to S-2-haloacid dehalogenase (Burkholderia sp. WS)
(S)-2-haloacid dehalogenase. [EC: 3.8.1.2]; 2-haloacid dehalogenase (configuration-inverting). [EC: 3.8.1.2, 3.8.1.10]

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-, 3.8.1.2

Use Curated BLAST to search for 3.1.3.- or 3.8.1.10 or 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>RALBFv3_RS00165 haloacid dehalogenase type II (Ralstonia solanacearum IBSBF1503)
MTSIRAVVFDAYGTLFDVYSVAARAEQLFPGRGEALSVLWRDRQIDYTRIRSLAGPSGEH
YKPFWDITVDALRYACARLGLALSAHNEATLMREYACLSAFPENVPVLRQLREMRLPLGI
LSNGNPQMLDIAVKSAGMSGLFDHVLSVDAVRQYKTAPAAYALAPQAFGVPAAQILFVSS
NGWDACGATWYGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQARQSMR