Protein Info for RALBFv3_RS00020 in Ralstonia solanacearum IBSBF1503

Annotation: fluoride efflux transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details PF02537: CRCB" amino acids 8 to 119 (112 residues), 89.4 bits, see alignment E=9.3e-30 TIGR00494: protein CrcB" amino acids 8 to 120 (113 residues), 85.9 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 96% identical to CRCB_RALSO: Putative fluoride ion transporter CrcB (crcB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K06199, CrcB protein (inferred from 94% identity to rsl:RPSI07_2034)

MetaCyc: 41% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>RALBFv3_RS00020 fluoride efflux transporter CrcB (Ralstonia solanacearum IBSBF1503)
MSGMGLVAVGVGAALGAWLRWAFAVLWNAINPALPYGTLAANLLGGYLIGVAVGFFDTHA
GLPPEWRLLAVTGFLGGLTTFSTFSSEVIANILAGDYAVGMLHVAAHLGGSLFLTLLGLW
TVRTLS