Protein Info for Psyr_5129 in Pseudomonas syringae pv. syringae B728a

Annotation: chromosome segregation DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF02195: ParB_N" amino acids 27 to 127 (101 residues), 132.6 bits, see alignment E=8.1e-43 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 35 to 202 (168 residues), 202.1 bits, see alignment E=3.3e-64 PF17762: HTH_ParB" amino acids 130 to 228 (99 residues), 122.6 bits, see alignment E=1e-39 PF23552: ParB_C" amino acids 242 to 290 (49 residues), 87.9 bits, see alignment 3.5e-29

Best Hits

Swiss-Prot: 86% identical to PARB_PSEPU: Probable chromosome-partitioning protein ParB (parB) from Pseudomonas putida

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to psb:Psyr_5129)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL16 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Psyr_5129 chromosome segregation DNA-binding protein (Pseudomonas syringae pv. syringae B728a)
MAVKKRGLGRGLDALLSSPTVSSLEEQAVKAPPSELQHVPLDLIQRGKYQPRRDMDPQAL
EELAQSIKSQGVMQPIVVRPIGDNRFEIIAGERRWRASQQAGVETIPAMVRDVPDETAIA
MALIENIQREDLNPIEEAMALQRLQQEFQLTQQQVADAVGKSRVSVANLLRLIALPEAIK
TMLSHGDLEMGHARALLGLGEDRQVEGARHVVARGLTVRQTEALVRQWLSGKAEAAEPVK
TDPDISRLEQRLAERLGSAVQIRHGQKGKGQLVIRYNSLDELQGVLAHIR